PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G013600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 381aa    MW: 41920.2 Da    PI: 7.913
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G013600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox551.3e-17208262256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++keq   Lee F+++++++ +++  L+k+l+L  rqV vWFqNrRa+ k
  Aqcoe1G013600.1.p 208 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALSKQLNLRPRQVEVWFQNRRARTK 262
                        678899***********************************************98 PP

2HD-ZIP_I/II123.97.7e-40208297191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        +kk+rlskeq+++LEesF+e+++L+p++K +l+++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++d l+een+rL+ke +eLr +l
  Aqcoe1G013600.1.p 208 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALSKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRRCDFLTEENRRLHKEIQELR-AL 297
                        69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.7E-1036164IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.3E-16193258IPR009057Homeodomain-like
SuperFamilySSF466897.7E-18200265IPR009057Homeodomain-like
PROSITE profilePS5007116.682204264IPR001356Homeobox domain
SMARTSM003891.9E-15206268IPR001356Homeobox domain
PfamPF000464.9E-15208262IPR001356Homeobox domain
CDDcd000862.34E-15208265No hitNo description
PROSITE patternPS000270239262IPR017970Homeobox, conserved site
CDDcd146860.00409257296No hitNo description
SMARTSM003404.2E-23264307IPR003106Leucine zipper, homeobox-associated
PfamPF021831.8E-10264298IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MELGLSLGET TSSSSRQQTF TFVDKPSTTS TTATKMVNNN KGLGFCMSLG LSGFNNATEE  60
EQQHHREREV RKKDGRNDKE KRSTDLPDPS PLQLDLLPIA SVPRNPAPST QGLPWLSENG  120
NSEAGSSGQL GVSVRGFDVN QSPSTEEVDD GAAVSSPNST VSSFQIDFSI YRGGNGNKRD  180
SETAGLNEAE ADRTSSKASD DDENGSGRKK LRLSKEQSAF LEESFKEHNT LNPKQKLALS  240
KQLNLRPRQV EVWFQNRRAR TKLKQTEVDC EYLKRRCDFL TEENRRLHKE IQELRALKSS  300
QPYYMQLPAT TLTMCPSCER VATTTPTTTT TTTTTTNNSG SAENSTTTTI NTPIGSGFSL  360
TKPRYYPFSH PHPHQSAAPS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256264RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257490.11e-144PREDICTED: homeobox-leucine zipper protein HOX11 isoform X2
SwissprotP466654e-91HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLF6HPT41e-122F6HPT4_VITVI; Putative uncharacterized protein
STRINGVIT_13s0156g00260.t011e-122(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-82homeobox from Arabidopsis thaliana